SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006593 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006593
Domain Number 1 Region: 11-189,322-465,540-593
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.47e-45
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 2 Region: 680-1025
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.23e-41
Family WD40-repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 968-1135,1194-1246
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.63e-27
Family WD40-repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006593   Gene: ENSVPAG00000007085   Transcript: ENSVPAT00000007086
Sequence length 1248
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_965:457184:646869:1 gene:ENSVPAG00000007085 transcript:ENSVPAT00000007086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRTAPSCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGH
NDDIISLALHPDKTLVATGQVGKEPYICIWDSYNVQTVSILKDVHTHGVACLAFDSDGQR
LASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFWTLC
GNALTAKRGIFGKTGDLQTILCLACAKEDITYSGALNGDIYVWKGLNLVRTIQGAHSXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEQGYNGLSIRSVCWKADRLLAGT
QDSEIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALI
ARCNMEEAVRSVAFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDG
SYLAVGSNDGPVDVYAVAQRYKKIGECNKSLSFITHIDWSLDSKYLQTNDGAGERLFYRM
PSGKPLTSKEEIKGIPWASWTCVKGPEVCGVWPKYTDVTDINSVDANYNSSVLVSGDDFG
LVKLFRFPCLKKGAKFRKYVGHSAHVTNVRWSHDFQWVLTKGGADHSVFQWRFIPKGVSN
GLLETPRQEGGTDSYSEESDSDLSDVPELDSDIEQETQINYDRQVYKEDLPQLKQQSKEK
NHAVPFLKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHSQ
RLYLGHDDDILSLTIHPVKDYVATGQLGRDAAIFVWDTQTLKCLSLLKGQHQRGVCALDF
SADGKCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGIKHI
KFWQQAGGGFTSKRGIFGSVGKLETMMCVSYGRMEDLVFSGAATGDIFIWKDILLLKTVK
AHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERCLKTYAIKRAALSTSSKGLLLEDNPS
IRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDK
TLRIWELSSQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMVSFHH
RKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSKRVGICKGASGYITHIDWDCRXXXX
XXXXXXXXXXXXXXXXGKRHIIRPSEIEKIEWDTWTCVLGPTCEGIWPAHSDVTDVNAAS
LTKDCSLLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLH
Download sequence
Identical sequences ENSVPAP00000006593 ENSVPAP00000006593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]