SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006864 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006864
Domain Number 1 Region: 32-126
Classification Level Classification E-value
Superfamily Cystatin/monellin 3.91e-25
Family Cathelicidin motif 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006864   Gene: ENSVPAG00000007382   Transcript: ENSVPAT00000007382
Sequence length 165
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2404:1286:3133:1 gene:ENSVPAG00000007382 transcript:ENSVPAT00000007382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQRASLSLRCWSLWLLLLGLAVPWASAQALSYREAVLRAVDRLNEQSSDPNLYRLLEL
DLPPKADEDLDAPKPVSFTVKETVCPRRTQLPPEQCAFKENGVVKQCLGTVNLYQLRDNY
DITCNESVGFFGRIHDFFRDGVNWVRDKVGKVIGYIGDKIPRVES
Download sequence
Identical sequences ENSVPAP00000006864 ENSVPAP00000006864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]