SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007124 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007124
Domain Number 1 Region: 180-282
Classification Level Classification E-value
Superfamily ALDH-like 4.97e-23
Family ALDH-like 0.0000455
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily ALDH-like 7.59e-19
Family ALDH-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007124   Gene: ENSVPAG00000007659   Transcript: ENSVPAT00000007660
Sequence length 413
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_30:704:6286:1 gene:ENSVPAG00000007659 transcript:ENSVPAT00000007660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVFESEVSEISISQSEIDSALRNLRAWMKDEKVSKNLATQLDSAFIRKEPFGLVLIVAPW
NYPVNLTLVPLVGALAAGNCVVLKPSEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRVAW
FRFNTGQTCVAPDYVLCSPEMQARLLPALQSAITRFYGEDPQSSPDLGRIINHKHFQRLR
DLLSCGRVAIGGQSDESERYIAPTVLVDVQETEPVMQEEIFGXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSGMGSYHG
KFSFDTFSHHRACLLRRPGLEKIYAIRYPPHSPRNLRLLLLAMEARGCSCTLL
Download sequence
Identical sequences ENSVPAP00000007124 ENSVPAP00000007124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]