SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007239 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007239
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.74e-72
Family Alanine racemase-like, N-terminal domain 0.000000000673
Further Details:      
 
Domain Number 2 Region: 267-417
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.34e-49
Family Eukaryotic ODC-like 0.000000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007239   Gene: ENSVPAG00000007782   Transcript: ENSVPAT00000007782
Sequence length 461
Comment pep:known_by_projection scaffold:vicPac1:scaffold_9532:248:4030:-1 gene:ENSVPAG00000007782 transcript:ENSVPAT00000007782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSFSNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSRTIVKTLAAIGTGFDCASKTEIQLVQSLGVPPEKIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLL
LERAKELDIDVIGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFNMYLLDIGGGFPG
SEDVKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKLVLKEQ
TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPTWQLMQQI
QNRDFPPEVEEQDVSTLPVSCAWESGMKRHPAACASASINV
Download sequence
Identical sequences ENSVPAP00000007239 XP_006191917.1.101512 XP_006197170.1.17985 XP_010962326.1.22495 ENSVPAP00000007239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]