SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007262 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007262
Domain Number 1 Region: 245-375
Classification Level Classification E-value
Superfamily ApaG-like 6.41e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 64-230
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.07e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily F-box domain 0.0000174
Family F-box domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000007262
Domain Number - Region: 383-416
Classification Level Classification E-value
Superfamily ARM repeat 0.00691
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007262   Gene: ENSVPAG00000007806   Transcript: ENSVPAT00000007806
Sequence length 435
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_160:1568280:1603757:-1 gene:ENSVPAG00000007806 transcript:ENSVPAT00000007806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAA
IKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLV
VPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEG
RNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVNNVVSGGFPIIRDQIFRYVHDP
ECVATTGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITN
AKGDVEEVQGPGVVGEFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVA
IPRFHMACPTFRVSIARLEMGPDEYEEMEEEEEEEEEEDDDDSADMDESDEDEEEERRRR
VFDVPIRRRRCSRLF
Download sequence
Identical sequences ENSVPAP00000007262 ENSVPAP00000007262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]