SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007280 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007280
Domain Number 1 Region: 87-325
Classification Level Classification E-value
Superfamily vWA-like 4.13e-81
Family Integrin A (or I) domain 0.000000209
Further Details:      
 
Domain Number 2 Region: 586-674
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.16e-19
Family Integrin beta tail domain 0.001
Further Details:      
 
Domain Number 3 Region: 371-416
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000105
Family Integrin domains 0.0029
Further Details:      
 
Domain Number 4 Region: 543-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family Integrin beta EGF-like domains 0.0035
Further Details:      
 
Domain Number 5 Region: 502-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000007280
Domain Number - Region: 46-108
Classification Level Classification E-value
Superfamily Integrin domains 0.00157
Family Integrin domains 0.0072
Further Details:      
 
Domain Number - Region: 468-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0198
Family Integrin beta EGF-like domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007280   Gene: ENSVPAG00000007825   Transcript: ENSVPAT00000007825
Sequence length 725
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1989:4760:17187:-1 gene:ENSVPAG00000007825 transcript:ENSVPAT00000007825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFLQEGMPTSARCDDLEALKKKGCHPDDIENPRGSKDIKKNKNVTNRSKGTAEKLQPEDI
TQIQPQQLVLQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLNVKSLGTDLMNK
MKRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVF
NELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGG
IVLPNDGQCHLENDVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLI
PKSAVGTLSANSSNVIQLIIDAYNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXVQFEISITSNKCPNKDSENVKIKPLGFTEEVEIILEFICECECQSEGIP
SSPRCHDGNGTFECGACRCNEGRVGRQCECSTDEVNSEDMDAHCRKENSSEICSNNGECV
CGQCVCRKRDNTNEVYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDC
SLDTSSCLAVNGQICNGRGVCECGACRCTDPKFHGPTCEMCQTCLGVCAEHKECVQCRAF
DKGEKKDTCAQECSHFNVTKVESRDRLPQPGQVDPLSHCKEKDVDDFFFYFTYSVNGNNE
ATVHVVETPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMN
AKWDT
Download sequence
Identical sequences ENSVPAP00000007280 ENSVPAP00000007280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]