SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007441 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007441
Domain Number 1 Region: 16-90
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.41e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007441   Gene: ENSVPAG00000008001   Transcript: ENSVPAT00000008000
Sequence length 244
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_450:493:3828:-1 gene:ENSVPAG00000008001 transcript:ENSVPAT00000008000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQ
QTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSAXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXLLPTPAPTHHPTVIVPAPAPPPSHHINVVTMGPSSVINSVSTSRQNLD
TIVQ
Download sequence
Identical sequences ENSVPAP00000007441 ENSVPAP00000007441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]