SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007524 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007524
Domain Number 1 Region: 83-161
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.09e-25
Family Regulator of G-protein signaling, RGS 0.0000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007524   Gene: ENSVPAG00000008085   Transcript: ENSVPAT00000008084
Sequence length 161
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1512:10681:60983:-1 gene:ENSVPAG00000008085 transcript:ENSVPAT00000008084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TWXXXXXXXXXXXXXXXXXXXXXXXXXNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRAL
XXXXXXXXXXXXXXXXXXXXXXXGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLV
SKAHRIFEEFVDVQAPREVNIDFQTREATRKMQEPSLTCFD
Download sequence
Identical sequences ENSVPAP00000007524 ENSVPAP00000007524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]