SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007598 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007598
Domain Number 1 Region: 52-302
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.8e-58
Family Carbonic anhydrase 0.000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007598   Gene: ENSVPAG00000008163   Transcript: ENSVPAT00000008163
Sequence length 331
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2117:5774:561747:-1 gene:ENSVPAG00000008163 transcript:ENSVPAT00000008163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERIRSCLGPVLIELNELHVASGRESAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVN
SAWNLCSVGRRDSLNASSHMIFDPFLTPIRIHAEGKKVSGTMYNTGRHVLRLDKEHLVNI
SGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPN
GLVVVSIFIKXXXXXXXXXXXXXXXXXXXXXXXXXDAYLLQGLNIEELYPETSSFITYDG
SMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCI
RTNINFSLQGKDCPNNRAQRLQYRVNEWLLK
Download sequence
Identical sequences ENSVPAP00000007598 ENSVPAP00000007598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]