SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007621 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007621
Domain Number 1 Region: 11-135
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.07e-31
Family PaaI/YdiI-like 0.00000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007621   Gene: ENSVPAG00000008189   Transcript: ENSVPAT00000008189
Sequence length 140
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2801:2182664:2192164:1 gene:ENSVPAG00000008189 transcript:ENSVPAT00000008189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCKGKNMMEMMKFLSSHRDFDRVLDKVNLVSAVPGKMICEMKVEEQHTNKMGTLHGGMT
ATLVDCISTFALICSERGVPGVSVDMNITYMSPAKIGDDIVITAHILKQGKTLAFASVDL
TNKATGKLIAQGRHTKHLGN
Download sequence
Identical sequences ENSVPAP00000007621 ENSVPAP00000007621 XP_006198738.2.17985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]