SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007659 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007659
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 4.6e-30
Family Ran-binding protein mog1p 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007659   Gene: ENSVPAG00000008234   Transcript: ENSVPAT00000008234
Sequence length 136
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_802:2371:4651:1 gene:ENSVPAG00000008234 transcript:ENSVPAT00000008234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLELQAHVQGEEAARYHFEDVAGVQEARAVQVEAVQPLPLENLALRGCCQEAWILSGKQ
QVAKENQQVAKYVTLHQALLRLTQYQTDLLLTFNQPPPEDRSSLGPENSLLPWSLGDFEQ
LVTSLTLHDPNIFSPQ
Download sequence
Identical sequences ENSVPAP00000007659 ENSVPAP00000007659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]