SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007669 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007669
Domain Number 1 Region: 347-386
Classification Level Classification E-value
Superfamily LEM domain 0.000000000922
Family LEM domain 0.0079
Further Details:      
 
Domain Number 2 Region: 11-71
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000187
Family Ankyrin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007669   Gene: ENSVPAG00000008246   Transcript: ENSVPAT00000008243
Sequence length 388
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2245:670:108432:1 gene:ENSVPAG00000008246 transcript:ENSVPAT00000008243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAAGLARRLRVALREEELRVVEELLRRGADPNLVLEDGAAAMHLAARARHPRSLSCLE
ALLRCGGDPNARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGPPGPPNVTLDSTALDRGDSKDMNL
KASPGPPSLLAHPNIADADGISGSPLGRWDCSSVASFVTAVEASGAEEPCPDTYPWTGSN
PPRGCQDLRVPHNWSSPHGRETELNARLQALTLTLPDASPSSKSFPDRSPANRPPWEPPS
GPCEFHFQKDDQSLDSDVAALWLTEDEASSMGSRDPVPSCQCPLDPTISDLELLQALRAL
GESPGPITPFSRPHYLRRLEEAQAAPGP
Download sequence
Identical sequences ENSVPAP00000007669 ENSVPAP00000007669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]