SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007823 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007823
Domain Number 1 Region: 9-130
Classification Level Classification E-value
Superfamily DNA clamp 1.13e-17
Family DNA polymerase processivity factor 0.013
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000007823
Domain Number - Region: 153-233
Classification Level Classification E-value
Superfamily DNA clamp 0.0879
Family DNA polymerase processivity factor 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007823   Gene: ENSVPAG00000008408   Transcript: ENSVPAT00000008408
Sequence length 423
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2878:386430:419235:1 gene:ENSVPAG00000008408 transcript:ENSVPAT00000008408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCGMSGSQVKVFGKAIQALSRINDELWLDPSEKGLSLRSMNSGRSAYGCVFFSSVFFQ
HYQWSVKTNDSDTILNLNCKLGMKSILPIFRCLNSLERNVEKCKIFTSSDKCKVVIQFFC
RHGIKRIHNICFQESQPVQVIFEKNMCINTLMIQPRVLAEAIVLFPSSQEEVTLAATPLS
VCIKSSNEDSMDLTKSVYSEMFVGRDEFDFYQIGVNTEITFYFKELKGMLTFSEATHVPI
SMYFDFPGKPLALSVDDMLLEANFILATLADEPSRASSPQSLCLSQKRKRSDSIHSNSKA
GKNATGKVPEYISRKVVPRRLYHNETLTNISVLENGGSPLKNRGNRDVSEVPESSVSDTE
EVPGSPYLRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCRKKFNGRDAKYF
CII
Download sequence
Identical sequences ENSVPAP00000007823 ENSVPAP00000007823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]