SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007841 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007841
Domain Number 1 Region: 25-98
Classification Level Classification E-value
Superfamily Apolipoprotein A-II 1.96e-34
Family Apolipoprotein A-II 0.0000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007841   Gene: ENSVPAG00000008426   Transcript: ENSVPAT00000008426
Sequence length 100
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3616:215123:216461:-1 gene:ENSVPAG00000008426 transcript:ENSVPAT00000008426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLAVTVLLLTICSFEGALVRRQAEEPSLQSLVSQYFQTVTDYGKDLVEKAKGSELQTQ
AKAYFEKTQEQLTPLVKKAGTDLINFLSNFMDLKTQPPAQ
Download sequence
Identical sequences ENSVPAP00000007841 ENSVPAP00000007841 XP_006215749.1.17985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]