SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007857 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007857
Domain Number 1 Region: 268-364
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000089
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.005
Further Details:      
 
Domain Number 2 Region: 99-167
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000223
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.069
Further Details:      
 
Domain Number 3 Region: 15-56
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000968
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007857   Gene: ENSVPAG00000008443   Transcript: ENSVPAT00000008442
Sequence length 818
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3544:743392:781421:1 gene:ENSVPAG00000008443 transcript:ENSVPAT00000008442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSF
FDVALKSSPADRNGVQDNCRTKFRDSLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQ
DYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCPDSGQRIDEANGLPQPGGYY
DPDQLPPENSFMERCFICRLRCLLDNSSGFLAMNFQGRLKYLHGQNKKGKDGSVLPPQLA
LFAIATPLQPPSILEIRNKNFIFRTKHKLDFTPTGCDAKGKIVLGYTEAELRMRGSGYQF
IHAADMLYCAEYHIRMIKTGESGMVVFRLLTKDNRWAWVQSNARLVYKNGRPDYIIATQR
PLTDEEGTEHLRKRNMQLPFLFTTGEAVLYEISNPFPPMMDPLPIRTKHGASGKESATQS
TLSKDSLNPSSLLNAMMQQDESIYLCPASSSTSFKRNFFNQSLNECSNWQNSVAPVGSDN
LLKHEPVGQSQEMNLSLSGDHAGLFPDNRNSDLYSIMQRLGIDFEDIKHMQENEEFFQTD
FSEENDFGDIDLTDEILTYVEDSLNKPTFRCSSFHQPQSVALNASCMVQEQLQLEQQLQR
QRKLTAVEPQQLCQKMKHMQVNGMFANWNSDQSVPFTCPQQDLQQYIFSDLPGTSQDFPX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLEDFVTCLQVPEN
QKHGLNPQSAVLTPQTCYAGAVSMYQCQPEPQHSHVAPMQYDPSLPGPEAFLNKFQNGGV
LNETSPAQLPSINNTQTATHLHPSEARPFPDWTSSGFL
Download sequence
Identical sequences ENSVPAP00000007857 ENSVPAP00000007857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]