SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007872 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007872
Domain Number 1 Region: 440-726
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.54e-69
Family Protein kinases, catalytic subunit 0.000000436
Further Details:      
 
Domain Number 2 Region: 280-363
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-34
Family Kringle modules 0.00035
Further Details:      
 
Domain Number 3 Region: 30-118
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-20
Family I set domains 0.032
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000007872
Domain Number - Region: 139-226
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00235
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007872   Gene: ENSVPAG00000008458   Transcript: ENSVPAT00000008458
Sequence length 906
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_415:619198:801017:1 gene:ENSVPAG00000008458 transcript:ENSVPAT00000008458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TELSVTAELVPTSSWNISSELDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRW
FKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFX
XXXXXXXXXXDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGT
SSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNP
MILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNNTGVDYRGTVSVTRSG
RQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC
DSKDSKEKNKMEILYILVPSVAIPLAIALLFFFICVCRNNQKSSSPPVQRQPKHVRGQNV
EMSMLNAYKPKSKAKELPLSAVRFMEESGECALGKIYKGHLYLPGMDHAQLVDIKTLKDY
NNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQEQPVCMLFEYMNQGDLHEFLIMRSPHS
DVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKI
SDLELSREIYSADYYRVQSKSLLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQ
PYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWEG
LSSHTSSTTPSGGNATTQTTSLSASPVSNLSNPRYPNYMFPSQGITPQGQIAGFISPPIP
QNQRFIPINGYPIPPGYAAFPAAHYQPPGPPRVIQHCPPPKSRSPSSASGSTSTGHVTSL
PSSGSNQEANIPLLPHMSIPNHPGGMGITVFGNKSQKPYKIDSKQPSLLGDSNIHGHTES
MISADL
Download sequence
Identical sequences ENSVPAP00000007872 ENSVPAP00000007872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]