SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007975 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007975
Domain Number 1 Region: 1-138
Classification Level Classification E-value
Superfamily Nudix 2.66e-23
Family IPP isomerase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007975   Gene: ENSVPAG00000008569   Transcript: ENSVPAT00000008569
Sequence length 152
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_240:339:1748:-1 gene:ENSVPAG00000008569 transcript:ENSVPAT00000008569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFPGCFTNTCCSHPLSNPGELEENDAIGVRRAAQRRLKAELGIPMEEVPPEEINYLTRIH
YQAQSDDIWGEHEIDYILFVKKDVTLNPDPNEIKSHCYVSKEELKELLKKAASGEVKITP
WFQIIAETFLFKWWDNLNHLNPFVDHEKIHRM
Download sequence
Identical sequences ENSVPAP00000007975 ENSVPAP00000007975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]