SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008027 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008027
Domain Number 1 Region: 168-465
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 6.67e-42
Family NadC C-terminal domain-like 0.03
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000008027
Domain Number - Region: 37-54,94-133
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.0135
Family NadC N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008027   Gene: ENSVPAG00000008623   Transcript: ENSVPAT00000008621
Sequence length 472
Comment pep:novel genescaffold:vicPac1:GeneScaffold_463:848472:880112:-1 gene:ENSVPAG00000008623 transcript:ENSVPAT00000008621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTHYKQYPPNTSKVYSYFECREKKTENSKIRKVKYEETVFYGLQYILNKYLKGKVVTKEK
IQEAKEVYREHFQDDVFNEKGWNYILEKYDGHLPIEVKAVPEGSVIPRGNVLFTVENTDP
ECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETAGNLDGLEYKLHDFGYRGVS
SQETAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEK
DAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTEAPLIIRPDSGNPLD
TVLKVLDILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKKWSIENVS
FGSGGALLQKLTRDLLNCSFKCSYVVTNGLGVNVFKDPVADPNKRSKKGRLSLHRTPAGN
FVTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEVRKNAQLNIELETAPH
Download sequence
Identical sequences ENSVPAP00000008027 ENSVPAP00000008027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]