SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008122 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008122
Domain Number 1 Region: 73-129
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-18
Family Fibronectin type II module 0.0037
Further Details:      
 
Domain Number 2 Region: 42-85
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000314
Family Fibronectin type II module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008122   Gene: ENSVPAG00000008723   Transcript: ENSVPAT00000008727
Sequence length 130
Comment pep:known_by_projection scaffold:vicPac1:scaffold_5781:49324:54599:1 gene:ENSVPAG00000008723 transcript:ENSVPAT00000008727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLRIVVMETTRNFSSLFLVFLNEFPPTVETITHLPEVKDGKCFFPFHHRDGIFYDCVKF
KSKHKWCSLNKTYQGYWKYCSEEDFAKCVFPFWYRHLIYWECTDDGDAFGKTWCSLTQNY
NKDKVWKYCD
Download sequence
Identical sequences ENSVPAP00000008122 ENSVPAP00000008122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]