SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008179 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008179
Domain Number 1 Region: 746-818
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000000000695
Family Phosphate binding protein-like 0.0000524
Further Details:      
 
Domain Number 2 Region: 154-272
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000000377
Family L-arabinose binding protein-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008179   Gene: ENSVPAG00000008789   Transcript: ENSVPAT00000008789
Sequence length 885
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_702:1427:53413:1 gene:ENSVPAG00000008789 transcript:ENSVPAT00000008789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGGPRGPRGPAKMLLLLALACASPFPEEVPGPGGVGGPGGGPGGARPLNVALVFSGP
AYATEAARLGPAVAPVRPGLDVMALKLNFAYPVCHSVCLYLLSXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKGSTFLQLGSSTEQQLQVIFEVLEEYDWT
SFVAVTTRAPGHRAFLSYIEVLTDGSMVGWEHRGALTLDPGAGEAVLGAQLRSVSAQIRL
LFCAREEAEPVFRAAEAGLTGPGYVWFMVGPQLAGGGGSGARGXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPYSPAVWVMMFVMCLTVVAVTVFIFEY
LSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVLVWAFFA
VIFLASYTANLAAFMIQEEYVDTVSGLSDRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXKLDAFIYDAAVLNYMARKDEGCKLVTIGSGKVFAT
TGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKLDIDNMA
GVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSR
Download sequence
Identical sequences ENSVPAP00000008179 ENSVPAP00000008179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]