SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008196 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008196
Domain Number 1 Region: 331-691
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.37e-76
Family YicI catalytic domain-like 0.00053
Further Details:      
 
Domain Number 2 Region: 1187-1379,1417-1585
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.56e-73
Family YicI catalytic domain-like 0.00039
Further Details:      
 
Domain Number 3 Region: 963-1183
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.57e-44
Family YicI N-terminal domain-like 0.0088
Further Details:      
 
Domain Number 4 Region: 163-330
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.22e-36
Family YicI N-terminal domain-like 0.0055
Further Details:      
 
Domain Number 5 Region: 1588-1668
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.45e-16
Family Putative glucosidase YicI, domain 3 0.018
Further Details:      
 
Domain Number 6 Region: 694-774
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000403
Family Putative glucosidase YicI, domain 3 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008196   Gene: ENSVPAG00000008803   Transcript: ENSVPAT00000008809
Sequence length 1808
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_448:590440:729834:-1 gene:ENSVPAG00000008803 transcript:ENSVPAT00000008809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKKFTRLEIFLIVLFTIVTIIAIALVAVLATKTPAVEEINDSTSTPATTHTTTVYPGS
GKCPSDLNDPVNERINCIPEQFPTRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTDPNNRRYEVHQFVKEFS
GSAASDTLYDVKVTENPFSIRVARKSNNRILFDTSIGPLVYSDQYLQISARLSSEYMYGI
GEHVHKRFRHDLNWKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSNA
MELFIQPTPIVTYRVTGGILDFYVFLGDTPEQVVQQYQELIGRPAMPAYWSLGFQLSRWN
YKTLDVVKEVVQRNREAGIPFDTQITDIDYMEDKKIFTYDKVAFNGLPEFVQDLHDHGQK
YVIILDPAISIEKRTNGTAYETYDRGTEQKVWVNESDGTTAIIGEVWPGLTVYPDFTSPN
CIEWWVNECNLFHQEVNYDGLWIDMNEVSSFVQGSKKGCSDNNLNYPPFTPDILWGKNMM
FIASIQYGHSTEKAIQKVFPNKRSFILTRSTFAGTGSYAAHWLGDNTASWEQMEWSISGM
LEFGLFGMPLVGADICGFVAETTEELCRRWMQLGAFYPFSRNHNADGYEHQDPAFFGQNS
LLVNSSRHYLNIRYTLLPFLYTLFYKAHMFGETVARPFLHEFYEDTNSWIEDTQFLWGPC
LLITPVLRQGATIVSAYIPNATWYDYETGAKRPWKKQRVDMYLPGDKIGLHLRGGYIIPI
QQPAVTTTASRMNPLGLIVALDEDNTAKGDFFWDDGETTNTIQNGNYILYSFSVSNNKLD
IICTHSSYQEGTTLAFETIKILGLIDTVTEVTVVEDNQPMTAHYNFTYDASNQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPFGSKAPECYFPKE
DNSYLVHSTQYSSVGITADLQLNAVNARIKLPSDPIPALRVEVKYHKDDMLQFKIYDPQN
KRYEVPVPLNIPTTPISTYENRLYDVEIKENPFGIQIRRRSTGRVIWDSRLPGFAFNDQF
IQISTRLPSEYVYGFGEVQHTAFKQDLNWHTWGMFTRDQPPGYKLNSYGFHPYHMSLEDD
SHAHGVLLLNSNAMDVTFQPTPALTYRIIGGILDFYMFLGPSPEVATKQYHEVIGRPIMP
PYWALGFQLCRYGYRNTSEVQQVYNDMVTARIPYDVQYTDIDYMERQLDFTIDDEFWDLP
QFVDKIRNEGMRYIIILDPAISGNETKPYPAFERGQEKDVFVKWPNTNDVCWGKVWPGLP
NVTIDESLTEDEAVNASRAHVAFPDFFRNSTAEWWAREIIDFYNNQMKFDGLWIDMNEPS
SFVNGTTTNQCRNEVLNYPPYFPELMKRTDGLHFRTMCMETEHILSDGSSVLHYDVHNLY
GWSQVKPTYDALQKATGKRGIVISRSTYPTAGQWAGHWLGDNYAKWDSLDKSIIGMMEFS
LLGMSYTGADICGFFNNSEYQLCARWMQLGAFYPYARNHNAAFTRRQDPASWNETFSEMS
RKILNIRYTLLPYFYTQMHEIHAYGGTVIRPLLHEFFDEKPTWDIFKQFLWGPAFMVTPV
LEPYVDTVEGYVPNARWFDYHTGKDIGIRGTFHTFAAPLYEINVHVRGGHILPCQEPAQN
TFYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILKN
GYINKSEMRLGYIHIWGKEKTRVSEVNLIYNGNKESLNFIEDPNLEILDIDLRVKNVTLD
DPIEINWS
Download sequence
Identical sequences ENSVPAP00000008196 ENSVPAP00000008196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]