SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008328 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008328
Domain Number 1 Region: 4-140
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.48e-18
Family L-arabinose binding protein-like 0.0067
Further Details:      
 
Domain Number 2 Region: 601-710
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000013
Family Phosphate binding protein-like 0.000011
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000008328
Domain Number - Region: 214-269
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0942
Family L-arabinose binding protein-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008328   Gene: ENSVPAG00000008952   Transcript: ENSVPAT00000008952
Sequence length 829
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2131:937500:1097826:1 gene:ENSVPAG00000008952 transcript:ENSVPAT00000008952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQDALI
SIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEK
KKERLVVVDCESERLNAILGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYTSALTYDGVKVMAEAFQSLRRQRIDI
SRRGNAGDCLANPAVPWGQGIDIQRALQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
RSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRKKSKGKYAYLLESTMNEYIEQRKPCDTM
VGNLDSKGYGXXXXXXXXXXGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDK
TSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSIKEAIRTS
TLPRNSGAGASGGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL
Download sequence
Identical sequences ENSVPAP00000008328 ENSVPAP00000008328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]