SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008466 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008466
Domain Number 1 Region: 29-286
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.41e-63
Family Carbonic anhydrase 0.00000843
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008466   Gene: ENSVPAG00000009097   Transcript: ENSVPAT00000009096
Sequence length 290
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3000:261570:358823:-1 gene:ENSVPAG00000009097 transcript:ENSVPAT00000009096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLSFIEDSVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREAR
YDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWG
RENQRGSEHTVNFKAFPMELHLIHWNATCSVVIDEXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXGKSKIIPCFNPNTLLPDPLLRDYWVYEGSLTVPPCSEGVTWILFRYPL
TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Download sequence
Identical sequences ENSVPAP00000008466 ENSVPAP00000008466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]