SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008489 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008489
Domain Number 1 Region: 263-345
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.57e-23
Family ADP-ribosylglycohydrolase 0.0034
Further Details:      
 
Domain Number 2 Region: 2-95
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 0.00000000000119
Family ADP-ribosylglycohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008489   Gene: ENSVPAG00000009120   Transcript: ENSVPAT00000009120
Sequence length 355
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1845:843:2758:1 gene:ENSVPAG00000009120 transcript:ENSVPAT00000009120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEKYVAAMVLSAAGDALGYFNGKWEFLRNGEEIHRQLAQLGGLDAIDVERWRVSDDTVMH
LATAETPKAGNVLNLARLYSLLAKHYQDCMGDMDGRAPXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSYFQDQWEKYLKLRGIWDGKSV
PTFPKPFDVKERDQFYTSVSYSGWGGSSGHDAPLIAYDAILAAGDSWKELAHRAFFHGGD
SDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLRSKEDTVITL
Download sequence
Identical sequences ENSVPAP00000008489 ENSVPAP00000008489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]