SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008955 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000008955
Domain Number - Region: 196-227
Classification Level Classification E-value
Superfamily Kringle-like 0.0942
Family Kringle modules 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008955   Gene: ENSVPAG00000009622   Transcript: ENSVPAT00000009622
Sequence length 384
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_962:834211:886552:-1 gene:ENSVPAG00000009622 transcript:ENSVPAT00000009622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQAGFPLGILLLFWVSYITDFSLVLLIKGGALSGTDTYQSLVNKTFGFPGYLLLSVLQF
LYPFIVDPENLLIGRHFIIVLSTIAFTLPLSLYRDIAKLGKXXXXXXXXXXXXXXXXXXX
XXXXXXXXPKTEDAWIFAKPNAIQAVGVMSFAFICHHNCFLVYGSLEEPTVAKWSRIIHV
STLISVFISILFATCGYLTFTGFTQGDLFENYCRNDDLVTFGRFCYGVTVILTYPIECFV
TREVIANVFFGGNLSPFFHIIITVIIITVATLVSLLIDCLGIVLELNGVLCAAPLIFIIP
SACYLKLSEERRTHSDKIMSCVMLPIGAVVMVVGFVMAVTNPQDCTHGQEMFYCFPDNSS
LTNISVSHFQLTTQPPILNISTFQ
Download sequence
Identical sequences ENSVPAP00000008955 ENSVPAP00000008955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]