SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009063 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009063
Domain Number 1 Region: 35-501
Classification Level Classification E-value
Superfamily ALDH-like 7.86e-83
Family ALDH-like 0.0000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009063   Gene: ENSVPAG00000009734   Transcript: ENSVPAT00000009738
Sequence length 507
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2126:117105:153759:-1 gene:ENSVPAG00000009734 transcript:ENSVPAT00000009738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLLINQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQXXXXXX
XXXXXXXXXXXXXXXXIPAPKRGEVVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQ
EYVDICDYAVGLSRMIGGPILPSERPGHVLVEQWNPVGLVGVITAFNFPVAVYGWNNAIA
MICGNACLWKGAPTTSLISVAVTKIVAKVLEDNKLPGAICSLTCGGADIGTAMAKDERVN
LLSFTGSTQVGKQVALMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQ
RCTTARRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLYGPLTKQAVSMLGAVEEAKKEG
GTVVYGGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNEDEVFVWNNEVK
QGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDA
WKQYMRRSTCTINYSKDLPLAQGIKFH
Download sequence
Identical sequences ENSVPAP00000009063 ENSVPAP00000009063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]