SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009115 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000009115
Domain Number - Region: 69-98
Classification Level Classification E-value
Superfamily LysM domain 0.000471
Family LysM domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009115   Gene: ENSVPAG00000009794   Transcript: ENSVPAT00000009794
Sequence length 305
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_368:1505721:1510574:-1 gene:ENSVPAG00000009794 transcript:ENSVPAT00000009794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRHQNRSFPLPGVHSSGPVHAFGNCTDNDMLEEDAEMYELRSRGKEKIRRSTSRDRLD
DIIVLTKDIQEGDTLNAIALQYCCTVANINRVNNLISDLHFFALRSVKIPSKNFNSLTET
LYPPGIQASRPSSVQYLAEQQEVLSANDSLSSSESAGSFLKEVDRDIEQIVKCTDTKREN
LNEVVSALTAQQIRFEPDNKNIQRKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYYE
ILAKVDVSHHSTVDSSHLHSGVTPPSQQREMENGIAPTKGIPFGPQEDHKLYSQNSQLPA
AQYKT
Download sequence
Identical sequences ENSVPAP00000009115 ENSVPAP00000009115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]