SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009121 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009121
Domain Number 1 Region: 586-664,881-1085
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.41e-62
Family Protein kinases, catalytic subunit 0.00052
Further Details:      
 
Domain Number 2 Region: 102-265,295-352
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.8e-18
Family Quinoprotein alcohol dehydrogenase-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009121   Gene: ENSVPAG00000009801   Transcript: ENSVPAT00000009801
Sequence length 1114
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2381:267872:460533:-1 gene:ENSVPAG00000009801 transcript:ENSVPAT00000009801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERATRPGSLARALLLPLLLGIAAGTVDARLASDIPAPTAEAAFLGAAAAPTAAARVPAA
GAVTAAEVTVEDAEALPAAAGEQEEREPEPEDEAELRPCGRSLVIISTLDGRIAALDPEN
HGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMETVPFTVESLL
ESSYKFGDDVVLVGGKSLTTYGLGAYSGKVRYICSALGCRQWDSDEVEPEEGILLLQRTQ
KTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTLKPHGNKEQSKIISDVDEQE
AVMMDTVIKVSVADWKVMAFSKKEGHLEWEYHFCTPIASAWLVKDGKVVPISLFDDTSYA
PNDGVLEDEEDIVEAARGATESSVYLGMYRGQLYLQSSVRISEKFPTSPKALESVNGENA
IIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGYYL
PYYKRERSKRSTQITVRFLDNPNYSKNVRRKDPVLLLHWWKEIVGTILFCIVATTFIVRR
LFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWSDIKNSGYVSRYLTDFEPVQCMGRG
GFGVVFEARNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLEAP
PEKWQEKMDEIWLKDESTDWPLSSPSPVDAPSVKVRRMDPFSTKERIEIIAPSPRSGRSF
SVGISCGRTSSSESQFSPLEFSGMDHRDMSESVDAVNNLPDSCLTDCDVEDGTMDGNDEG
HSFELCPSEASPNIRSRERTSSSIVFEDSGCDNASSKEEPRTNRPPLGNHYANKLTAVQH
SNSRPSSEPTFSISPPRPTTLSLDLTTNPAEKPQPSSPKVYLYIQMQLCRKENLKDWLNS
RCTIEERERSACLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTAM
DQDEEDQMVLTPMPGYARHTGQVGTKLYMSPEQIHGNNYSHKVDIFSLGLILFELLYPFA
TQMERVRILTDVRDLKFPPLFTQKYPREYAMVQDMLSPCPTERPEAANIIENAIFEDLEF
PGKTVLRQRSRSLSSSGTKHSRHSSSSHSPLPSN
Download sequence
Identical sequences ENSVPAP00000009121 ENSVPAP00000009121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]