SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009145 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009145
Domain Number 1 Region: 495-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.38e-59
Family Eukaryotic proteases 0.00000000485
Further Details:      
 
Domain Number 2 Region: 115-209
Classification Level Classification E-value
Superfamily Kringle-like 1.93e-35
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 210-294
Classification Level Classification E-value
Superfamily Kringle-like 1.14e-33
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 4 Region: 302-385
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-31
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 5 Region: 381-477
Classification Level Classification E-value
Superfamily Kringle-like 1.01e-28
Family Kringle modules 0.0004
Further Details:      
 
Domain Number 6 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 5.49e-22
Family Hairpin loop containing domain 0.00000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009145   Gene: ENSVPAG00000009828   Transcript: ENSVPAT00000009828
Sequence length 728
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_85:226199:296881:-1 gene:ENSVPAG00000009828 transcript:ENSVPAT00000009828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPVLLLQHVLLHLLLLPIAIPYAEGQKKRRNTLHEFKKSSKTTLIKEDPLLKIK
TKKMNSADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTMNDTDVPM
ETTECIQSQGEGYRGTTNTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGA
ESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRD
LKDYEAWLGIHDVHGRGDEKRKQVLNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTIDLP
NYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQYHQGKVILNESEICAG
AENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVPQS
Download sequence
Identical sequences ENSVPAP00000009145 ENSVPAP00000009145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]