SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009192 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009192
Domain Number 1 Region: 17-628
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 2.09e-228
Family Aconitase iron-sulfur domain 2.26e-16
Further Details:      
 
Domain Number 2 Region: 633-847
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.81e-71
Family LeuD-like 0.00000000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009192   Gene: ENSVPAG00000009876   Transcript: ENSVPAT00000009877
Sequence length 850
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1134:144549:178888:1 gene:ENSVPAG00000009876 transcript:ENSVPAT00000009877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPFAHLAEPLDPAQPGKKFFNLNKLKDPRYERLPFSIRVLLEAAIRNCDQFLVKKNDV
ENILNWNVLQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPICPA
DLVIDHSIQVDFSRRADSLQKNQDLEFERNRERFEFLKWGSQAFCNMRIIPPGSGIIHQV
NLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLP
QVIGYRLMGNPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMC
PEYGATAAFFPVDEVSIKYLVQTGREEEKVKHIKKYLQAVGMFRDFSDPSQDPDFAQVVE
LDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPDHHNDHKTFIYNNS
EFSLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLSVKPYIKTSLSPGSGVVTY
YLRESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEAVVEAITQGDLVAVGVLSGNRNFEG
RVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVSAKGQQVFLKDIWPTRDEIQVVE
RQYVIPGMFKEVYQKIETVNESWNALAAPSDKLYCWNPKSTYIKSPPFFEDLTLDLQPPK
SIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMA
RGTFANIRLNKSDQQAPQTIHLPSGEILDVFDAAERYQQAGLPLIILAGKEYGSGSSRDW
AAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTISIPET
LKPRMKVQVK
Download sequence
Identical sequences ENSVPAP00000009192 ENSVPAP00000009192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]