SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009242 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000009242
Domain Number - Region: 343-429
Classification Level Classification E-value
Superfamily Tropomyosin 0.0105
Family Tropomyosin 0.022
Further Details:      
 
Domain Number - Region: 256-292
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0824
Family RILP dimerisation region 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009242   Gene: ENSVPAG00000009932   Transcript: ENSVPAT00000009931
Sequence length 439
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3566:666203:863181:1 gene:ENSVPAG00000009932 transcript:ENSVPAT00000009931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDWSKGIAHSYLEQETTGRNKSTQPDEQLTVNSKGSMHQKHSELVNEATNEDTELPEQR
SRNFQLISPHPGDEIVYGTTEIMEHRSNDLHYECMIPREVTSDLNKEKTIAFLLKELDVL
KASNKKLQEKLTKEDKEQRKLKLKLELQEKATEAQIAEKTAALVEEVYFAQKERDEAVMS
RLQLANEERDEAIARAKHMEMSLKVLENINPEENDMTLQELLNRINNADTGIAIQKNGAV
IVDRIYKTKECRKRITAEEMNAVIEERDAALSQCKRLEQELHHLKEQNQTSANNMRHLTA
ENNQERALKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHKSLSQEENLKDQFNHTL
STYEEALKNRENIVSITQQQNDELATQLQQALTDRANMELELQHAVEASRAANDKVQKLE
RLVDVLRKKVGTGTMRTVI
Download sequence
Identical sequences ENSVPAP00000009242 ENSVPAP00000009242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]