SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009272 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009272
Domain Number 1 Region: 7-158
Classification Level Classification E-value
Superfamily PR-1-like 5.89e-55
Family PR-1-like 0.00000295
Further Details:      
 
Domain Number 2 Region: 167-222
Classification Level Classification E-value
Superfamily Crisp domain-like 4.18e-16
Family Crisp domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009272   Gene: ENSVPAG00000009963   Transcript: ENSVPAT00000009963
Sequence length 222
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2751:170915:260312:-1 gene:ENSVPAG00000009963 transcript:ENSVPAT00000009963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPAFGTLSTAHKEVQIKIVDKHNDLRRTVSPPASNMLKMQWDSKAAANAQNWANQCLYKH
SKAKDRTIGTRQCGENLFMSSSPTSWSNAIQSWYDEINDFTYGVGPKRPQAVVGHLTQVV
WYSSFRVGCGIAYCPNQRILKYFYVCQYCPAGNIIDRQYVPYLQGTRCASCPKHCDNGLC
TNSCEYDNTYANCDSLKKQWTCNVPFVKNNCKAACKCSDKIY
Download sequence
Identical sequences ENSVPAP00000009272 ENSVPAP00000009272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]