SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009297 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009297
Domain Number 1 Region: 72-194
Classification Level Classification E-value
Superfamily FKBP-like 5.11e-39
Family FKBP immunophilin/proline isomerase 0.00041
Further Details:      
 
Domain Number 2 Region: 182-271
Classification Level Classification E-value
Superfamily FKBP-like 1.37e-26
Family FKBP immunophilin/proline isomerase 0.00058
Further Details:      
 
Domain Number 3 Region: 4-79
Classification Level Classification E-value
Superfamily FKBP-like 1.41e-23
Family FKBP immunophilin/proline isomerase 0.001
Further Details:      
 
Domain Number 4 Region: 338-403
Classification Level Classification E-value
Superfamily FKBP-like 1.79e-22
Family FKBP immunophilin/proline isomerase 0.00094
Further Details:      
 
Domain Number 5 Region: 415-484
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000557
Family Calmodulin-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009297   Gene: ENSVPAG00000009991   Transcript: ENSVPAT00000009991
Sequence length 495
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1572:1323848:1427675:1 gene:ENSVPAG00000009991 transcript:ENSVPAT00000009991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YDRDSTFNVFVGKGQLIAGMDQALVGMCVNERRFVKIPPNLAYGSEGVSGVIPPNSVLHF
DVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDFVRYHYNGTFLDGTLFDSSHNRMKTYD
TYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDGKDIPGQASLVFDVALLDLH
NPKDSISIENKVVPENCERRSQSGDFLRYHYNGTLLDGTLFDSSYSRNRTFDTYIRGYVI
AGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWNLGKTYNIVLGSGQVVLGMDMGLRE
MCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGLPEGYMFIWNGEVSAN
LFEEIDKDGDGEVLLEEFSEYIHGQVASGKGKLAPGFDAEMIVKNMFTNQDRNGDGKVTA
EEFKLKDQEAKHDEL
Download sequence
Identical sequences ENSVPAP00000009297 ENSVPAP00000009297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]