SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009321 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000009321
Domain Number - Region: 42-106
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00797
Family Motor proteins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009321   Gene: ENSVPAG00000010018   Transcript: ENSVPAT00000010018
Sequence length 130
Comment pep:known_by_projection scaffold:vicPac1:scaffold_18652:4184:5627:1 gene:ENSVPAG00000010018 transcript:ENSVPAT00000010018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLRNKLKARDHXXXXXXXXXXXXXXXXXXXLLHAALRAWVIQCWWRSMQAKMLEQRRRL
ALRLYTCQEWAVVKVQAQVRMWQARRRFLQARQAACIIQSHWRWHASQTRGLIQGRYEVK
ASRLELDIEI
Download sequence
Identical sequences ENSVPAP00000009321 ENSVPAP00000009321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]