SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009423 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009423
Domain Number 1 Region: 149-267
Classification Level Classification E-value
Superfamily DNA clamp 2.58e-18
Family DNA polymerase processivity factor 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009423   Gene: ENSVPAG00000010127   Transcript: ENSVPAT00000010127
Sequence length 276
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_917:1037730:1044922:-1 gene:ENSVPAG00000010127 transcript:ENSVPAT00000010127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQPIPDESDYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVXXXXXXXX
XXXXXAGIFQEFTVQEESVTFRINLTVLLDCLSIFGSSPTPGTLTALRMCYQGYGYPLML
FLPFDFLVCKINTQDEDLFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITMSPDKP
YFRLSTFGNAGSSHLDYPKDSDLMESFQCTQTQVNRYKISLLKPSTKALVLSCKVSIRTD
NRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPESES
Download sequence
Identical sequences ENSVPAP00000009423 ENSVPAP00000009423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]