SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009462 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009462
Domain Number 1 Region: 53-369
Classification Level Classification E-value
Superfamily ARM repeat 3.25e-20
Family HEAT repeat 0.056
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000009462
Domain Number - Region: 350-407
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00392
Family VPS28 N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009462   Gene: ENSVPAG00000010170   Transcript: ENSVPAT00000010170
Sequence length 507
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2964:664:37157:-1 gene:ENSVPAG00000010170 transcript:ENSVPAT00000010170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESEDTKKIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNAGVYFREIGGL
IFVKNLAKSSEHSMVKEAALYTLGAVAEQNVYCQQTLCTSELFEDLTWFLSDNDSNTNLK
RMSVYVILVLVSNNRIGQTLVRETGCISVLSHLFRTVLSKYELNLSDKNVFQNYQLWSSV
CSTLCVCVNNPQNDENQMLCCSLFPHANDWLINCMQPEIIRPICSFIGLTLANNTNIQKI
SVGGLDVSQVLVQLESDSHETLSSAKLAVVVTKTVDACIADNPTFGAVLSKYHIVSKLLA
LLLHESLDSGEKFSIILTLGHCTEDCAEKLSLSLGEYSFDENEVEQLKDINMKEKNLEEY
WKKAKEILHRIEQLERAGNEEKIQTEKYEDTFSSVNINIQNTFKHLHADSSGGGPKAEDK
DKSPSRRLQSHKSHEAMSKACTNNDQMKTLLKSANPVNTCYRESRQNKTVCKTDSSSNQN
VCEETTFEKKNFVSQSRSIYIMFRYNK
Download sequence
Identical sequences ENSVPAP00000009462 ENSVPAP00000009462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]