SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009466 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009466
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.00000000000055
Family Carbonic anhydrase 0.00048
Further Details:      
 
Domain Number 2 Region: 105-143
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.0000000249
Family Carbonic anhydrase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009466   Gene: ENSVPAG00000010175   Transcript: ENSVPAT00000010174
Sequence length 145
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2964:91211:93341:1 gene:ENSVPAG00000010175 transcript:ENSVPAT00000010174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMEKFRSLLFTSEDDE
RIHMVNNFRPPQPLKGRVVKASFRA
Download sequence
Identical sequences ENSVPAP00000009466 ENSVPAP00000009466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]