SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009494 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009494
Domain Number 1 Region: 328-468
Classification Level Classification E-value
Superfamily C-type lectin-like 1.19e-40
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 2 Region: 767-903
Classification Level Classification E-value
Superfamily C-type lectin-like 4.64e-38
Family C-type lectin domain 0.00034
Further Details:      
 
Domain Number 3 Region: 646-770
Classification Level Classification E-value
Superfamily C-type lectin-like 1.5e-36
Family C-type lectin domain 0.000000925
Further Details:      
 
Domain Number 4 Region: 2-132
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.61e-35
Family Cysteine rich domain 0.000000984
Further Details:      
 
Domain Number 5 Region: 910-1017
Classification Level Classification E-value
Superfamily C-type lectin-like 8.46e-32
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 6 Region: 208-324
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-28
Family C-type lectin domain 0.00096
Further Details:      
 
Domain Number 7 Region: 132-190
Classification Level Classification E-value
Superfamily Kringle-like 7.14e-20
Family Fibronectin type II module 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009494   Gene: ENSVPAG00000010203   Transcript: ENSVPAT00000010203
Sequence length 1026
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1548:240182:317831:1 gene:ENSVPAG00000010203 transcript:ENSVPAT00000010203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRQFLIYNEDHKRCVEAVSPSSVQTAVCNQDNEAQRFRWVSASQIMSVAFKLCLGVPSKT
DWVPITLYACDSKSEFQKWECKNDTLLGIEGEDLFFNYGNRQEKNIMLYKGSGLWSRWKV
YGTTDDLCSRGYEAMYTLLGNANGAACAFPFKFENKWYADCTNAGRPDGWLWCGTTTDYD
ADKLFGYCPLKFEGSESLWTKDPLTSISYQINSKSALTWHQARKSCQQQNAELLSITEIH
EQTYLTGLTSTLTSGLWIGLNSLSFNSGWQWSGGSPFRYLNWLPIPSAEPGKSCVSLNPG
KSAKWENLQCVQKLGYICKKGNTTLNSFVIPSESDTPTNCPSQWWPYTGNCYRIYREEKK
IQRDALTACRKEGGDLASIHSIEEFDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGTP
VTFTKWLRGEPSHENNRQEDCAVMKGKDGYWADRACERPLGYICKTKSQAQTSGIVEGET
GCRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFTKGKHEKKTWFESRDFCRA
LGGDLASINNKEEQQAIWRLVTASGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYG
EPNNYQNVEYCGELKGDPSMSWNDINCEHLNNWICQIRKGQTPNPEPTPAPQDNPPVTED
GWVIYKDYQYYFSKEKETMDKAREFCKKNFGDLVSIQSESEKKFLWKYVNRNDAQQAYFI
GLLISLDRKFAWMDGSKVDYVAWATGEPNFANDDENCVTMYSNSGFWNDINCGYPNAFIC
QRHNSSINATAIPTAPSAPGGCKEGWSFYNHKCFKIFGFLEEERKNWQEARKACIGFGGN
LASIQNEKEQAFLTYHMKDSTFNAWTGLNDVNSEHTFLWTDGRGVSYTNWGKGFPGGRRS
SLSYED
Download sequence
Identical sequences ENSVPAP00000009494 ENSVPAP00000009494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]