SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009509 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009509
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily UBC-like 8.33e-40
Family UEV domain 0.000000275
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000009509
Domain Number - Region: 349-370
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.017
Family VPS23 C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009509   Gene: ENSVPAG00000010218   Transcript: ENSVPAT00000010218
Sequence length 377
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1265:517911:582203:-1 gene:ENSVPAG00000010218 transcript:ENSVPAT00000010218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKYRDLTVRETINVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICL
WLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVV
FGDEPPVFSRPTISASYPPYQATGPPNTSYIPGMPSGISAYPSGYPPNPSGYPGCPYPPG
GQYPVTTSSQYPSQPPVTTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVRLLSRKQFQL
RALMQKARKTAGLSDLY
Download sequence
Identical sequences ENSVPAP00000009509 ENSVPAP00000009509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]