SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009652 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009652
Domain Number 1 Region: 161-353
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.86e-40
Family Transferrin 0.0000344
Further Details:      
 
Domain Number 2 Region: 363-496
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.72e-35
Family Transferrin 0.00015
Further Details:      
 
Domain Number 3 Region: 574-698
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.72e-31
Family Transferrin 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009652   Gene: ENSVPAG00000010373   Transcript: ENSVPAT00000010373
Sequence length 700
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3050:242425:279431:-1 gene:ENSVPAG00000010373 transcript:ENSVPAT00000010373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGSSALWLFLALCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSDYFGGSCVPGAGETSHS
QSLCRLCRGNAAGEGVCDKSPLERYYDYSGAFRXXXXXXXXXXXXXXXXXXXXXXXKTLA
SWGQVLLSKDFELLCRDGSRADVTEWRPCHLSRVPAHAVVVRADTNGGLNFRLLFERHLL
FSHDGSSFQMFSSEAYGQKNLLFKDATSELVPIATQTYEAWLGREYLHAMKGLLCDPNRL
PHYLRWCVLSTPEIQKCGDMAVAFSRQRLKPEIQCVSAESPQHCIEQIQGEDIYTAGKTY
GLIPAAGEHYAPEDRSNSYFVVAVVKRNSSYAFTLDELRGKRSCHPAFGNPTGWDIPVGA
LVQKGFIRPRHCDVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNAEPWAAELRLEDYELLCPNGARAEVS
QFAACNLAQIPSHAVMVRPDNYIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLL
FKDATIRAVPVGEKTTYHDWLGQDYVAALEGMLSQQCSGT
Download sequence
Identical sequences ENSVPAP00000009652 ENSVPAP00000009652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]