SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009775 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009775
Domain Number 1 Region: 98-141
Classification Level Classification E-value
Superfamily LysM domain 0.000000109
Family LysM domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009775   Gene: ENSVPAG00000010501   Transcript: ENSVPAT00000010504
Sequence length 925
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_878:597431:681879:1 gene:ENSVPAG00000010501 transcript:ENSVPAT00000010504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKKKKQAKQNAEAASAMAARTHTGKEVPNTVILEQDKCNVAVEEEYVTDEKKKRKSSQLK
EIRRTELKRYYSIDDNQNKAHDKNEKKRVVQTPHSSMEHAAGSQDTLNSIALKFNITPNK
LVELNKLFTHTIVPGQVLFVPDANFPSSTLRLSSSSPGATVSPSSSDAEYDKLPDADLAR
KALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSHMKIKDALPSDLPQDLCPLYRPGEWEDLASEKD
INPFSKFKSLSKEKRQQNGERIITSDSKSTRPLEKSTEYTQTKPSDSSVSRKLKKLESST
EAASGSTPVANIRKEPSDTQTAFESIAKENSLLGEDDDFVDLEELSSQTDSGMDKRDTSK
ECLSLGPEELRKTKSQIISSTMEKQAQSALNFSGPECDAELKGALDLETCEKQDIMPEVD
KQSGSPESQVENTLSIHEDLDKVKLIEYYLNKNKEGTQLSDNLQKAELTDGKSIEPLGID
ITLSSSLPQAGDPPTEGNKEPEKTWVKERPPLPLQLGSSTEENMNKECPDSSLESTLDNS
CQGAQMDNKSEIQLWLLKRIQVPIEDILPSKEEKSKTPPMFLCIKVGKPMRKSFATHMTA
MVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAKEQGFVVVEKEELNMIDN
FFSEPTTKSWEIITVEEAKRRKSTCSYYEDEEEAALPILQTHSALLENMHIEQLARRLPA
RVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMDNQIFGAYATHPFKFSDHY
YGTGETFLYTFSPNFKVFKWSGENSYFINGDISSLELGGGGGRFGLWLDADLYHGRSNSC
STFNNDILSKKEDFIVQDLEVWTFE
Download sequence
Identical sequences ENSVPAP00000009775 ENSVPAP00000009775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]