SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009996 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009996
Domain Number 1 Region: 623-1144
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.06e-151
Family alpha-mannosidase, C-terminal domain 0.00000195
Further Details:      
 
Domain Number 2 Region: 124-500
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.71e-141
Family alpha-mannosidase 0.00000000214
Further Details:      
 
Domain Number 3 Region: 503-615
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 7.85e-30
Family alpha-mannosidase, domain 2 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009996   Gene: ENSVPAG00000010735   Transcript: ENSVPAT00000010735
Sequence length 1145
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2010:986107:1171616:1 gene:ENSVPAG00000010735 transcript:ENSVPAT00000010735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPKNPHREGSFPQGQLSMLQEKIDHLER
LLAENNEIISNIRDSVINLSESVEDGPKSSQGNFSQGAGSPLLPSKQFSLSVDSEDCLFA
SRSGSQSSDVQMLDVYSLIPFDNPDGGVWKQGFDITYKSDEWDTKPLQVFVVPHSHNDPG
WLKTFEDYFREKTQYIFNNMVTKLKEDPRRKFMWSEISYLSKWWDTIDIQKKDAVKSLLE
NGQFEIVTGGWVMPDEAASHYFALIDQLIEGHQWLEKNLGVKPRSGWAVDPFGHSPTMTY
LLKRAGFSHMLIQRVHYAVKKHFALHKTLEFFWRQNWDLGSVTDIFCHMKPFYSYDIPHT
CGPDPKICCQFDFKRLPGGRYGCPWGVPPETIYPGNVQNRAEMLLDQYRKKSKLFRTTVV
LAPLGDDFRYCERTEWDHQFKNYQLLFDYLNSHPHYNVKIQFGTLSDYFDALDKEDETNG
KNSQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRILESHLRAAEILYYFALKQA
QQYKINKFLSSSHYVALTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMNLRKII
GHSSLLLILKDKRSYDSYSFDTFLEMDLKQRAQSSLPQKNVISLSAEPRYLVVYNPSEQD
REAVVSVCVSSHKAQVSSATGKPVEIQMSAVWDTASTVSQTAYEISFLAQMPPLGLKVYT
ILESASSNPHLAEYVLYNGNIENKGIFNMNNMKSAEEEITLENAFIKLRFSQSGLMQEMV
NKEDGRSHEVKVQFSWYGTTSKKDKSGAYLFLPDGEAKPYVYTTPPFVIVQRGRFFSDVT
SFFEHVTHRIRLYNIHGIEGQSVEVSNIVDIRKEHNREIAMRLFSSINSQNRFYTDLNGY
QIQPRMTMSKLPLQANVYPMATMAYIQDAKHRLTLLSAQSLGVSSLKSGQIEVIMDRRLM
QDDNRGLEQGVHDNKITANLFRILLEKRSVVNMEEEKKSVSYPSLLSHITSFFLNHPVFS
MTEKVPTPTLQLLGEFSPLLSSLPCDIHLVNLRTIQSKVDGKHSNEAALILHRKGFDCRF
SGRDTGLHCSTTQGKISVQKLFNKFTVVSLTPSSLSLMHSPSDARNISEINLSPMEISTF
RIQLR
Download sequence
Identical sequences ENSVPAP00000009996 ENSVPAP00000009996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]