SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009998 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009998
Domain Number 1 Region: 268-372
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000209
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00054
Further Details:      
 
Domain Number 2 Region: 32-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000432
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000009998
Domain Number - Region: 1064-1090
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.000186
Family Nuclear receptor coactivator interlocking domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009998   Gene: ENSVPAG00000010738   Transcript: ENSVPAT00000010738
Sequence length 1444
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1930:158203:239097:-1 gene:ENSVPAG00000010738 transcript:ENSVPAT00000010738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRSTEKRNREQENKYIEELAELIFANFNDI
DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKE
EGEDSQSCLICGLGRVPMKERPVFPSSESFPTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
TNEPQLVISLHMLHREQNVCVMNPDLTGQALGKPLNPISSSSPAHQALCSGNPGQDMSLG
SNMNFPINGPKEQMGMPMGRFGGSGGMNHVSSMQAATPQGSNYALKMNSPSQSSPGMNPG
QPNSMLSPRHRMSPGVAGSPRVPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQAL
SEGHGVSLGSSLASPDLKMGNLQRIPHMNPPPLSKMGSLDSKDCFGLYGEPSEGAAGQAE
SSCHAGEQKEASEPSLAPAVSSERPDGQSRLHDGKGQTKLLQLLTTKSDQMEPSPLSSSL
SDANKDSAGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKELNQEATS
TAPGSEVTIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTKL
IAMKTEKEEMSFEPSEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGAPAGSVDKQAIIN
DLMQLTAENSPVTPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAGP
FPPIRNNSPYSVIPQPGMMGNQGMIGNQGNLGNSSTXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXPIQMIRNPTSIPMRPSQLAQRQMLQPQVMNIXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXQPFGSSPDDLLCPHPAAESPSDEGALLDQLYL
ALRNFDGLEESQAVDPEQFSSQDSNIMLEQKAPVFPQQYASQAQMAQGSYTPMQDPNFHT
MGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQQXXXXXXXXXXXXXXXXX
XXXXXXXXXAPINAQMLAQRQREILNQHLRQRQMHQQQQQVQQRTLMMRGQGLNMTPSVV
APSGVPATLSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATAPQSPLMSPRMAHTQSPM
MQPSQANPAYQASSDMNGWAQGSMGGSSMFSQQSPPHFGQQANTSMYNNNMNINVSMATN
TGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGGSLFPNQLPGMDMIKQEG
DASR
Download sequence
Identical sequences ENSVPAP00000009998 ENSVPAP00000009998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]