SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010080 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010080
Domain Number 1 Region: 393-568,598-659
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-43
Family Voltage-gated potassium channels 0.0029
Further Details:      
 
Domain Number 2 Region: 663-849
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-42
Family cAMP-binding domain 0.00051
Further Details:      
 
Domain Number 3 Region: 35-124
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000571
Family Flavin-binding PAS domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010080   Gene: ENSVPAG00000010826   Transcript: ENSVPAT00000010826
Sequence length 1188
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1822:775421:1199923:-1 gene:ENSVPAG00000010826 transcript:ENSVPAT00000010826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVMQKP
CTCDFLHGPETRHDIAIAQALGSEERVEVTYYHKWSTICNTHIIPVKNQEGVAMMFIINF
EYVTDEENAASPERVNPILPVKTVNRKLFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSK
QSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSKCSPLVNISGPLDHSSPKRQWDRLYP
DMLQSSSQLTHSRSKESICSIRRASSVHDIEGFSVHPKNIFRDRHASEDNGRNVKGPFNH
IKSSLLGSTSDSNLNKYSTINKIPQLTLNFSDVKTEKKNTSPPSSDKTIIAPKVKDRTHN
VTEKVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIYTAIFTPYSA
AFLLNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEEVVSDPAKIA
IHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGA
AVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGQQIGKRYNDSDSSSGPS
IKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRL
YSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVLKGFPECLAD
ICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLTALYFLSRGSI
EILKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQREDLLEVLDMYPE
FSDHFLTNLELTFNLRHESAKADLLLRSQSMNDSEGDNSKLRRRKLSFDSEGEKESTTND
PEDSVDTIRHYQSSKKHFEEKKSRSSSFISSIDDEQKPLFSGLVDSPPGIGKAAGLGLEE
TVPTSGRIHIGKRSHSCKDIADPRGWERENAGTQADESSPSALQRAAWGISETESDLTYG
EVEQRLDLLQEQLNRLESQMTADIQTILQLLQKQTTVVPPAYSMVTAGAEYQRPIIRLTR
TSHPVASIKTDRSFSPSSQCPEMLDLEKSKLKSKDSLSSGVHLNTASEDNLTSLLKQDSD
LSLELHPPRQRKTYLHPIRHPSLTDSSLNTVGILGLHRHVSDPGLPGK
Download sequence
Identical sequences ENSVPAP00000010080 ENSVPAP00000010080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]