SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010211 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010211
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.55e-34
Family Alanine racemase-like, N-terminal domain 0.00000166
Further Details:      
 
Domain Number 2 Region: 269-334
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.74e-16
Family Eukaryotic ODC-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010211   Gene: ENSVPAG00000010964   Transcript: ENSVPAT00000010964
Sequence length 335
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1458:314716:338222:1 gene:ENSVPAG00000010964 transcript:ENSVPAT00000010964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEMELVQHIGVPASKIIYASPCKQIAQIKYAAKHGVQLLSFDNEMELAKVVKSHPSAXXX
XXXXXXXXXXLSLSLKFGSLSCRHLKAKRDHVVVGVSFHIGSGCPDPQAFAKSISDARLV
FEMGAELGHRMHILDLGGGFPGVEGAKMRFDEIASVINSALDLYFPEGCGVDILAKLGRY
YVTSAFTLAVSIIAKKEVLLDQPGREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXKPSTEQPVYSSSLWGPVVDGCDCVAEGLWLPQLHVG
DWLVFENMGAYTVGVGSLLRGAQTCRITYAMSRVA
Download sequence
Identical sequences ENSVPAP00000010211 ENSVPAP00000010211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]