SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010221 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010221
Domain Number 1 Region: 416-818
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-135
Family ALDH-like 0.00000000752
Further Details:      
 
Domain Number 2 Region: 207-307
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.73e-26
Family Post formyltransferase domain 0.0000137
Further Details:      
 
Domain Number 3 Region: 8-127
Classification Level Classification E-value
Superfamily Formyltransferase 6.02e-22
Family Formyltransferase 0.00000184
Further Details:      
 
Domain Number 4 Region: 868-902
Classification Level Classification E-value
Superfamily ALDH-like 0.00000827
Family ALDH-like 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000010221
Domain Number - Region: 327-398
Classification Level Classification E-value
Superfamily ACP-like 0.000864
Family Acyl-carrier protein (ACP) 0.016
Further Details:      
 
Domain Number - Region: 161-203
Classification Level Classification E-value
Superfamily Formyltransferase 0.0235
Family Formyltransferase 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010221   Gene: ENSVPAG00000010976   Transcript: ENSVPAT00000010977
Sequence length 903
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2761:679172:721488:-1 gene:ENSVPAG00000010976 transcript:ENSVPAT00000010977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYFKNKLKLALIGQSLFGQEVYSQLCKDGHRVVGVFTVPDKDGKADPLALAAEKNGTPVF
KFPRWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDVIDSPKHGSIIYHPSILPRHR
GASAINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSCDEPYDTVDALYNLFLEGIAMVE
AVQLIADGKAPRIPQPEEGATYEGIRRKEDAEISWDQPAEVLHNWIRGHDKVPGAWTEIN
GQMVTFYGSSLLNSSVPPGEPLEIKGAKKPGLVTKKGLVLFGNDGKALIVRNLQFEDGKM
IPASQYFSAGETSVVELTAEEVKVAEIIKVIWAGILSNVPVIEDSTDFFKSGARSMDVVR
LVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGEDQEAELVVDYVSKEVNEMTVK
MPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLVDVDKAVAAAKDAFENGEWGR
MNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLALKTHIGMSVQTFRYFAGWCDK
IQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMMLAWKSAACLAAGNTLVLKPA
QVTPLTALKFAELSAKAGFPKGVINIIPGSSGIAGQRLSEHPDIRKLGFTGSTLIGKQIM
KSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAVFFNKGENCIAAGRLFVEESI
HDEFVTKVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCEAGVREGATLVYGGRQV
QRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFQNGXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPFGGFKQSGFGKDLGEEALNEYLKTKTVT
LEY
Download sequence
Identical sequences ENSVPAP00000010221 ENSVPAP00000010221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]