SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010227 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010227
Domain Number 1 Region: 29-141
Classification Level Classification E-value
Superfamily FKBP-like 7.27e-40
Family FKBP immunophilin/proline isomerase 0.00000109
Further Details:      
 
Domain Number 2 Region: 256-416
Classification Level Classification E-value
Superfamily TPR-like 6.51e-33
Family Tetratricopeptide repeat (TPR) 0.0000000603
Further Details:      
 
Domain Number 3 Region: 142-253
Classification Level Classification E-value
Superfamily FKBP-like 3.34e-26
Family FKBP immunophilin/proline isomerase 0.000000681
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010227   Gene: ENSVPAG00000010984   Transcript: ENSVPAT00000010984
Sequence length 422
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_881:21606:69949:-1 gene:ENSVPAG00000010984 transcript:ENSVPAT00000010984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDEGAKNNGENPAAAVAEQGEDITSKKDRGVLKLIRRVGNSEETPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEMCHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRIKRKGEGYSNPNEGATVEIHLEGRCGGRM
FDCRDVGFIVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AK
Download sequence
Identical sequences ENSVPAP00000010227 ENSVPAP00000010227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]