SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010294 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010294
Domain Number 1 Region: 551-807
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.34e-77
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 211-315
Classification Level Classification E-value
Superfamily SRCR-like 8.11e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000514
Further Details:      
 
Domain Number 3 Region: 320-420
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 4 Region: 100-203
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0016
Further Details:      
 
Domain Number 5 Region: 431-480
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 
Domain Number 6 Region: 33-103
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-16
Family Kringle modules 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010294   Gene: ENSVPAG00000011053   Transcript: ENSVPAT00000011055
Sequence length 808
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2410:339001:408612:-1 gene:ENSVPAG00000011053 transcript:ENSVPAT00000011055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRPQPAFAPRLHAHAGRTPGPHPGGCPAGEPWVNVTDFGAPCLHWAEVPPFLERSPPAAW
AQLQGQHHNFCRSPDGAGRPWCFYGNAHGKVDWGYCDCRHGSVRLRGGKNEFEGTVEVYA
NGVWGLVCSSHWDDSDASVICHQLQLGGRGAAKQIPFSGLGLIPIYWSNVRCRGDEENIL
LCEKDIWQGGVCPQKMAAAVTCSFSQGPAFPALRLAGGSSAREGRVELYHAGQWGTVCDD
QWDDADAEVICRQLGLSGIAKAWSQAYFGEGTGPVMLDEVRCTGNELSIEQCPKSSWGEH
NCGHKEDAGVSCTPLTDGVIRLTGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQ
LGFKYGKQASANYFEESTGPIWLDDVSCSGKESSFLQCSRRPWGRHDCSHGEDVGIACSP
DGDGHRLSLGFPIRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXSLSSVCGLTLLHRRQKRIIGGKNSLLGGWHWQVSLRLRSSHADGRLLCGATLLS
SCWVLTAAHCFKRYGNSTRNYAVRVGDYHTLVPEEFEEEIGVQQIVIHRAYRPDSSDYDI
ALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIP
LLPKRFCAHRYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERSGESWVVYGVTSWG
YGCGVKDSPGVYTKVSAFVPWIKSVTKL
Download sequence
Identical sequences ENSVPAP00000010294 ENSVPAP00000010294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]