SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010354 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010354
Domain Number 1 Region: 314-496
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.54e-35
Family Eukaryotic proteases 0.00000744
Further Details:      
 
Domain Number 2 Region: 82-171
Classification Level Classification E-value
Superfamily Kringle-like 1.69e-26
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 3 Region: 1-44
Classification Level Classification E-value
Superfamily FnI-like domain 2.49e-18
Family Fibronectin type I module 0.00023
Further Details:      
 
Domain Number 4 Region: 175-239
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000118
Family Kringle modules 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010354   Gene: ENSVPAG00000011118   Transcript: ENSVPAT00000011118
Sequence length 498
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_268:55504:123051:-1 gene:ENSVPAG00000011118 transcript:ENSVPAT00000011118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRDEKTQMVYQQHESWLRPLLRGNRVEHCWCNGGQPQCHSVPVRXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXASATCYKDKGVTYRGTWSTVESGAECANWNSSGLASKP
YSGRRPDAIKLGLGNHNYCRNPDQDSKPWCYVFKAGKYISEFCSTPACSKKDDGDCYFGG
LAYRGTRSLTTSASCLPRNSMTLIGKGNPDGDTKPWCHVLKDHQLTWEYCDLPQCXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXHHLVGGGVTDRLVPGGGEVFGRKYVVHEEFDDDIYDNDIALLQLKSDSLSCAQESD
SVRTVCLPDADLQLPDWTECELSGYGKHEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXGDSGGPLVCMKDNHMTLVGIISWGLGCGQKDVPG
VYTKVTNYLDWIRDNTRP
Download sequence
Identical sequences ENSVPAP00000010354 ENSVPAP00000010354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]