SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010427 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010427
Domain Number 1 Region: 10-54
Classification Level Classification E-value
Superfamily LysM domain 0.00000000942
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010427   Gene: ENSVPAG00000011199   Transcript: ENSVPAT00000011198
Sequence length 783
Comment pep:known_by_projection scaffold:vicPac1:scaffold_193:317168:381816:1 gene:ENSVPAG00000011199 transcript:ENSVPAT00000011198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVS
SVESSPSLSPVSPLSPTSSEAEFDKTTNPDVHPKEATPSSTSTGIRPARVVSSTSEEEEA
FTEKFLKINCRYITSGKGTVSGVLLVTPNNIMFDPHKTDPLVQENGCEEYGIMCPMEEVM
SAAMYKEILDSKIKESLPIEIDQLSGRDFCHSKKITRSNTDEIDSRIRDAGNDSASTAPR
STEESLSEDVFTESELSPIREELISSDEQRQDKSSGASSESVQTIHQSGVECLTVISEAT
PDHLKSDSGLAANEVGTLSLKTDLNNLEMATKKGDQATDNFQEISGPKEQSTSIKGSADQ
DFLLKESSLHQEEGEKESMPCGEAAEFKQKLIVSKGKQGKEQNQDSETEVEELRKLWKTH
TMQQTKQQRENIQQVSQKEKHKXXXXXXXXXXSVLLKEKRRHRLHKFLCLRVGKPMRKTF
VSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYAEDTGEYTREPGFIVV
KKIEESETNEDSTNEAAAREWEVVSVAEYHRRIDALNTEELRTLCRRLQITTREDVNSKQ
VAPVKADLESESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKT
LYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTG
DNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTLSKKEDFFIQDIEIW
AFE
Download sequence
Identical sequences ENSVPAP00000010427 ENSVPAP00000010427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]